PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007017P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 65aa    MW: 7426.65 Da    PI: 10.9874
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007017P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRr g++KK +ELSvLCda++a+i+fss+gkl+ey++
  MELO3C007017P1 10 RIENRTTRQVTFSKRRGGLFKKTHELSVLCDAQIALIVFSSNGKLFEYCT 59
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
CDDcd002657.48E-37262No hitNo description
SuperFamilySSF554553.53E-29261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-29323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MGRGKIAIRR IENRTTRQVT FSKRRGGLFK KTHELSVLCD AQIALIVFSS NGKLFEYCTQ  60
TTWY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A4e-19259158MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B4e-19259158MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1egw_A3e-19259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-19259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-19259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-19259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A4e-19259158Myocyte-specific enhancer factor 2A
3kov_B4e-19259158Myocyte-specific enhancer factor 2A
3kov_I4e-19259158Myocyte-specific enhancer factor 2A
3kov_J4e-19259158Myocyte-specific enhancer factor 2A
3mu6_A3e-19259158Myocyte-specific enhancer factor 2A
3mu6_B3e-19259158Myocyte-specific enhancer factor 2A
3mu6_C3e-19259158Myocyte-specific enhancer factor 2A
3mu6_D3e-19259158Myocyte-specific enhancer factor 2A
3p57_A4e-19259158Myocyte-specific enhancer factor 2A
3p57_B4e-19259158Myocyte-specific enhancer factor 2A
3p57_C4e-19259158Myocyte-specific enhancer factor 2A
3p57_D4e-19259158Myocyte-specific enhancer factor 2A
3p57_I4e-19259158Myocyte-specific enhancer factor 2A
3p57_J4e-19259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-105LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-105LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011658351.11e-38PREDICTED: MADS-box protein FBP24 isoform X3
RefseqXP_011658354.11e-38PREDICTED: MADS-box protein FBP24 isoform X6
SwissprotQ9ATE56e-32FBP24_PETHY; MADS-box protein FBP24
TrEMBLB9I4N62e-31B9I4N6_POPTR; Uncharacterized protein
TrEMBLQ6UGS12e-31Q6UGS1_PETHY; MADS-box protein FBP24 (Fragment)
STRINGPOPTR_0012s14770.16e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.36e-28MIKC_MADS family protein